Protein Info for ABIE53_001900 in Paraburkholderia graminis OAS925

Annotation: ribose/xylose/arabinose/galactoside ABC-type transport system permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 53 to 90 (38 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 168 to 192 (25 residues), see Phobius details amino acids 221 to 242 (22 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 276 to 296 (21 residues), see Phobius details amino acids 302 to 319 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 50 to 313 (264 residues), 105.5 bits, see alignment E=1.4e-34

Best Hits

KEGG orthology group: None (inferred from 94% identity to rcu:RCOM_2037440)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>ABIE53_001900 ribose/xylose/arabinose/galactoside ABC-type transport system permease subunit (Paraburkholderia graminis OAS925)
MNSVAPRTDASPARKLSLGVARRYGIYLFLVALIALSGARSPTFLRADNVVNMLVQFAPL
GIVVIGQVFVILVGGLDLSVASVMATAAVIATAFDDTNHSAPAIFGVTLVLCIGAGLLNG
LLVTKRQVSPFLATFATAVVLDGLRFAYTQGAPSGNVPPLFHTLGTGSVAGVPVNVLLLL
ACAIVFGTLLHLSTFGRRVYMVGGNAVAARLVGVSPDTVRIACYAISALLAGLAGLILSG
YVGIVDNWVGRGFELDSIVAAVMGGLALSGGRGSLPGGLAGAAILVVVFNIVLLIGMPVQ
AQIIVKGVIIIGASACYVSRRQR