Protein Info for ABIE53_001718 in Paraburkholderia graminis OAS925

Annotation: L-lysine exporter family protein LysE/ArgO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 62 (23 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 114 to 132 (19 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details PF01810: LysE" amino acids 15 to 202 (188 residues), 117.8 bits, see alignment E=2.3e-38

Best Hits

KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 94% identity to bgf:BC1003_2195)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>ABIE53_001718 L-lysine exporter family protein LysE/ArgO (Paraburkholderia graminis OAS925)
MNWLSFSHGAALCASLIVTIGAQNAFVLRQGIMRSHVGKIVALCALSDCILISAGVGGAS
VLVERYPVFVHVMLYVGLAYLVWFGINALRRAVRPGHAVMDAGTGDGAPPAQRALPIVLM
TLAFTWLNPHVYLDTFLLIGTAGAREPDGARVAFAVGAMAVSCVWFIGLGWGARALAPLF
RRATAWRVLDGAIGSMILLLAVTQFR