Protein Info for ABIE53_001712 in Paraburkholderia graminis OAS925

Annotation: UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 TIGR00236: UDP-N-acetylglucosamine 2-epimerase" amino acids 1 to 353 (353 residues), 430.2 bits, see alignment E=3.4e-133 PF02350: Epimerase_2" amino acids 7 to 352 (346 residues), 386 bits, see alignment E=7e-120

Best Hits

Swiss-Prot: 56% identical to WECB_ECO57: UDP-N-acetylglucosamine 2-epimerase (wecB) from Escherichia coli O157:H7

KEGG orthology group: K01791, UDP-N-acetylglucosamine 2-epimerase [EC: 5.1.3.14] (inferred from 91% identity to bug:BC1001_1240)

MetaCyc: 56% identical to UDP-N-acetylglucosamine 2-epimerase (Escherichia coli K-12 substr. MG1655)
UDP-N-acetylglucosamine 2-epimerase. [EC: 5.1.3.14]

Predicted SEED Role

"UDP-N-acetylglucosamine 2-epimerase (EC 5.1.3.14)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 5.1.3.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (391 amino acids)

>ABIE53_001712 UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing) (Paraburkholderia graminis OAS925)
MAPLVKQMEADAGIDSVVCVTGQHQQMLDQVLELFAIEPDHNLAVMTANQTLNGLASRLI
ASLDEVLATVQPDRVLVHGDTTTASAAALAAFHRRIPIGHVEAGLRTRDLTQPWPEEMNR
RIVDVMSDLMFAPTPSSKQRLAEETLQGRVVVTGNTVIDALNLTAARIDSDPALRASLDA
RLPSIDGARPMLLVTGHRRESFGAGFANICAALGDLADGGSVQIVYPVHLNPNVRGPVQE
SLGARRNVHLIDPLDYLGFVRLMQRASLILTDSGGVQEEAPALGKPVLVMRDVTERPEAV
AAGTVRLVGTERAAIVRAVSALVDDPSERERFAHRMNPYGDGQASRRIVAALTGRPFDEF
APEALAISPASSLVNSSANAAPRIAETEFAK