Protein Info for ABIE53_001612 in Paraburkholderia graminis OAS925

Annotation: acyl dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 transmembrane" amino acids 65 to 83 (19 residues), see Phobius details PF01575: MaoC_dehydratas" amino acids 27 to 132 (106 residues), 88.2 bits, see alignment E=3.4e-29 PF13452: MaoC_dehydrat_N" amino acids 32 to 134 (103 residues), 22.3 bits, see alignment E=1.3e-08

Best Hits

Swiss-Prot: 51% identical to ECH1_MYCTU: Probable enoyl-CoA hydratase 1 (Rv0130) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 84% identity to bug:BC1001_1106)

Predicted SEED Role

"MaoC domain protein dehydratase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (159 amino acids)

>ABIE53_001612 acyl dehydratase (Paraburkholderia graminis OAS925)
MTAPSASPGAVFRDSAALRALVGGAALVSDWVTIDQPSVDRFAEATGDQQWIHVDPERAR
RESPFGGAIAHGFMTLSLIPALLQKTVRLEQRMAVNYGLNRVRFTSPVLVGSQLRAQFAV
ASVEDVDNAGVQVIWNVAVERQGADRPVCVAEFITRHYF