Protein Info for ABIE53_001493 in Paraburkholderia graminis OAS925

Annotation: osmoprotectant transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details amino acids 137 to 164 (28 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 36 to 207 (172 residues), 85.4 bits, see alignment E=2.2e-28

Best Hits

Swiss-Prot: 58% identical to OSMW_SALTY: Osmoprotectant import permease protein OsmW (osmW) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05846, osmoprotectant transport system permease protein (inferred from 82% identity to vei:Veis_2244)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>ABIE53_001493 osmoprotectant transport system permease protein (Paraburkholderia graminis OAS925)
MDTLAFMIDNLASIIRLTVEHIEIVGVGVGFAILTGVPLGIAITANERAARVVLYLAAIL
MTIPSVALFGLMIPVLSLIGQGIGFLPTVIALFLYSQLPIVRNTYTAITNIDPALREAAR
GIGMTTRQRLWKVEIPIALPIIMAGVRMAVVINVGIAAVAAYIGAGGLGKLISRGISQSD
PRQLIAGAILVSVLAIAADYGLGWVQRLLTPKGLRSPSRTGRLAVRLGAWASFRKSPHHA
Q