Protein Info for ABIE53_001288 in Paraburkholderia graminis OAS925

Annotation: DNA-binding transcriptional LysR family regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 PF00126: HTH_1" amino acids 10 to 68 (59 residues), 51.5 bits, see alignment E=7.6e-18 PF03466: LysR_substrate" amino acids 105 to 295 (191 residues), 98.7 bits, see alignment E=3.2e-32

Best Hits

Swiss-Prot: 36% identical to BAUR_PSEAE: HTH-type transcriptional activator BauR (bauR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 92% identity to bpy:Bphyt_1040)

Predicted SEED Role

"LysR family transcriptional regulator Bucepa02002399"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>ABIE53_001288 DNA-binding transcriptional LysR family regulator (Paraburkholderia graminis OAS925)
MFSQLTDLDLRLIRVFLAIVDAGGVSPAQATLNVGQSTISTQLATLETRLGYRLCERGRS
GFRLSARGAQFVDAARALLDAVDSFGMQARNVGRKLVGTLDIGMIGHTPVSASARISEAI
GRFRSRDQSVRFSILVRSPGELEELLLNGRIQIGIGYFWHRVPSLEYTEVFAEDQFAYCA
KEHPLFARAGEVTPAQAAAHEWAWRSYPLPEAESSTAGRNVTAVADNMEAVAMLVLSGHH
LGYLPGHFAAPFVEQGLLAALNPAVMRYRVAFHMVTRARQHRTDIVEAFLEDMKAAHAIE
AEK