Protein Info for ABIE53_001225 in Paraburkholderia graminis OAS925

Annotation: LysR family cys regulon transcriptional activator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF00126: HTH_1" amino acids 5 to 64 (60 residues), 51.3 bits, see alignment E=8.9e-18 PF03466: LysR_substrate" amino acids 89 to 291 (203 residues), 141.7 bits, see alignment E=2.2e-45

Best Hits

Swiss-Prot: 90% identical to CYSB_BURCJ: HTH-type transcriptional regulator CysB (cysB) from Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)

KEGG orthology group: K13634, LysR family transcriptional regulator, cys regulon transcriptional activator (inferred from 97% identity to bgf:BC1003_0836)

MetaCyc: 43% identical to DNA-binding transcriptional dual regulator CysB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Cys regulon transcriptional activator CysB" in subsystem Cysteine Biosynthesis or DNA-binding regulatory proteins, strays

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>ABIE53_001225 LysR family cys regulon transcriptional activator (Paraburkholderia graminis OAS925)
MNLHQFRFVREAVRQNFNLTEAAKALFTSQPGVSKAIIELEDELGVEIFTRHGKRVRSLT
EPGRIILQSVERILQEVESLKRVGKDYAAQDQGNLVIAATHTQARYSLPAAIAEFKKRFP
KVHLSILQGSPTQVAEMVLHDQADLCIATEAISNYKELVSLPCFQWHHVAVMQPDHPLLD
RKLLSLDDLTQYPLITYDNAFAGRTKINEAFRLRALHPDIVLEAIDADVIKTYVELGLGV
GIMADIAFNAERDRHLRAMPVGHLFGSNVTRVALKHGAYLRSYVYTLVELLSPGLNRRLI
EQALKGEHETYEL