Protein Info for ABIE53_000884 in Paraburkholderia graminis OAS925

Annotation: biopolymer transport protein TolR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details PF02472: ExbD" amino acids 16 to 146 (131 residues), 101.2 bits, see alignment E=2.4e-33 TIGR02801: protein TolR" amino acids 18 to 145 (128 residues), 139 bits, see alignment E=6.9e-45

Best Hits

KEGG orthology group: K03560, biopolymer transport protein TolR (inferred from 98% identity to bug:BC1001_0471)

Predicted SEED Role

"Tol biopolymer transport system, TolR protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (148 amino acids)

>ABIE53_000884 biopolymer transport protein TolR (Paraburkholderia graminis OAS925)
MAGSRSSSMRGGRSRRAMSDINVVPYIDVMLVLLVIFMVTAPLVAPSIVNLPTVGGAAPQ
QQTPPVIVNIRADGNMSVKYKDDAGAQQQEDMTKAGLNGFIADRAQSHPDQPVVIAADKT
VKYEVVMNVMSELKARGVKRVGLLVKSQ