Protein Info for ABIE53_000875 in Paraburkholderia graminis OAS925

Annotation: tRNA dimethylallyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 TIGR00174: tRNA dimethylallyltransferase" amino acids 12 to 297 (286 residues), 310.1 bits, see alignment E=7.1e-97 PF01745: IPT" amino acids 12 to 58 (47 residues), 24.5 bits, see alignment 1.7e-09 PF01715: IPPT" amino acids 43 to 289 (247 residues), 300.5 bits, see alignment E=1.1e-93

Best Hits

Swiss-Prot: 88% identical to MIAA_PARXL: tRNA dimethylallyltransferase (miaA) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K00791, tRNA dimethylallyltransferase [EC: 2.5.1.75] (inferred from 92% identity to bug:BC1001_0463)

MetaCyc: 56% identical to tRNA dimethylallyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-6274 [EC: 2.5.1.75]

Predicted SEED Role

"tRNA dimethylallyltransferase (EC 2.5.1.75)" (EC 2.5.1.75)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.75

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>ABIE53_000875 tRNA dimethylallyltransferase (Paraburkholderia graminis OAS925)
MTARPPTPIPCLLGPTASGKTAAALALATRRPIEIVSVDSALVYRQMDIGTAKPTAEERA
IAPHHLIDIVDPANAYSAAEFRADALRLTAEIQARGRLPLLVGGTMLYYKALTQGLNDLP
AADPNVRAQLDADAARDGWPALHARLAAVDPATAARLAPNDSQRIQRALEVFMLTGEAMS
TLLAAPARTDDAAADWRFVPIALEPSDRSVLHARIERRFDAMLENGFVDEVVKLRERGDL
SPEMPSMRCVGYRQVWEYLDGAVDYATMRDKGVFATRQLCKRQLTWLRSMDERVVVDCCD
REATARVLEVIEALT