Protein Info for ABIE53_000722 in Paraburkholderia graminis OAS925

Annotation: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 TIGR01670: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family" amino acids 15 to 168 (154 residues), 168.5 bits, see alignment E=5.2e-54 PF08282: Hydrolase_3" amino acids 82 to 153 (72 residues), 23.3 bits, see alignment E=4.9e-09

Best Hits

Swiss-Prot: 48% identical to KDSC_SHIFL: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (kdsC) from Shigella flexneri

KEGG orthology group: K03270, 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) [EC: 3.1.3.45] (inferred from 97% identity to bug:BC1001_0315)

MetaCyc: 48% identical to 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase monomer (Escherichia coli BL21(DE3))
3-deoxy-manno-octulosonate-8-phosphatase. [EC: 3.1.3.45]

Predicted SEED Role

"3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (EC 3.1.3.45)" in subsystem KDO2-Lipid A biosynthesis (EC 3.1.3.45)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (186 amino acids)

>ABIE53_000722 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) (Paraburkholderia graminis OAS925)
MAVAPPTATERASRVKLMIFDVDGVLTDGGLLFTAEGDTMKAFNSMDGHGMKLLRQAGIE
TAIITGRKSGIVAARAKEMHITHVYQGIDNKPQAFADLLEATGMSADECGYMGDDWVDLG
VMLKVGFAAAPANSHPEVIARAHWVSEARGGHGAAREVCDTLLRAQHKYEALLAAACSGE
TRGLVG