Protein Info for ABIE53_000718 in Paraburkholderia graminis OAS925

Annotation: RNA polymerase sigma-54 factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 PF00309: Sigma54_AID" amino acids 4 to 48 (45 residues), 54.8 bits, see alignment 9.9e-19 TIGR02395: RNA polymerase sigma-54 factor" amino acids 9 to 501 (493 residues), 465.9 bits, see alignment E=7.5e-144 PF04963: Sigma54_CBD" amino acids 139 to 330 (192 residues), 197.5 bits, see alignment E=2.7e-62 PF04552: Sigma54_DBD" amino acids 346 to 501 (156 residues), 218.5 bits, see alignment E=6.3e-69

Best Hits

Swiss-Prot: 65% identical to RP54_CUPNH: RNA polymerase sigma-54 factor (rpoN) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K03092, RNA polymerase sigma-54 factor (inferred from 97% identity to bug:BC1001_0311)

Predicted SEED Role

"RNA polymerase sigma-54 factor RpoN" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (503 amino acids)

>ABIE53_000718 RNA polymerase sigma-54 factor (Paraburkholderia graminis OAS925)
MKASLQLRLSQHLALTPQLQQSIRLLQLSTLELQQEVATAISQNPLLENEDDWIASPLRV
ASDGSLITQAPSSSAPPEQMGGNGSSSSSSERSENGEPQGVDEYNGLSGDGNGDASQWNL
DDYGRSGNASDDDDLPPLQIHESSTSLRDHLMAQLRVTQAGQRDRALVTFLIESLDDDGY
LAATLEEVLADLPEELEVDLDEMNAALALLHSFDPAGVGARSASECLKLQLLRLEPSPTR
ALALDIVSHYLELLAARDFTRLRKHLKANDDDLRDAHMLIRSLEPFPGAAYGKAEADYVV
PDIMVRKTAQGWQAELNPEVVPKLRINHLYANILRNNRGDPGSGSLRQQLQEARWLIKNI
QQRFETILRVAQAIVERQKSFFVHGEIAMRPLVLREIADTLGLHESTVSRVTTGKYMLTP
FGTLEFKYFFGSHVSTDTGGAASSTAIRALIKQLIGAENAKTPLSDSRIAELLAEQGFVV
ARRTVAKYREALRIPAVNLRKSL