Protein Info for ABIE53_000618 in Paraburkholderia graminis OAS925

Annotation: BirA family biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 TIGR00121: biotin--[acetyl-CoA-carboxylase] ligase" amino acids 42 to 299 (258 residues), 141 bits, see alignment E=2.2e-45 PF03099: BPL_LplA_LipB" amino acids 67 to 177 (111 residues), 57.1 bits, see alignment E=1.9e-19 PF02237: BPL_C" amino acids 254 to 299 (46 residues), 40.9 bits, see alignment 1.6e-14

Best Hits

KEGG orthology group: K03524, BirA family transcriptional regulator, biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase [EC: 6.3.4.15] (inferred from 96% identity to bug:BC1001_0218)

Predicted SEED Role

"Biotin--protein ligase (EC 6.3.4.9, EC 6.3.4.10, EC 6.3.4.11, EC 6.3.4.15)"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>ABIE53_000618 BirA family biotin operon repressor/biotin-[acetyl-CoA-carboxylase] ligase (Paraburkholderia graminis OAS925)
MNASRTPPQRPAAAANAADWRIDRERAVALFGAHAHDWPIEIVEETGSTNADLMSRVKAL
PRKAGALPRPIVRVAYLQTAGRGRRGRPWYAEPGNALLFSVACVLPRPLEGLAGLSLAVG
VALVDGLRSLPVAGPGQIALKWPNDVLLEGDKLAGILIETAWSTEHASAVVIGIGTNVKG
ADELAAKIGALNADAPPQARGTAPTALQRALPNANLTDTLAAELNALEPALQRFGAEGFA
PFQARWNAVHAYAGREVVLLEQGQEVTRGVAAGVDERGQLLLDTAAGRQSIATGDVSLRL
ADGAA