Protein Info for ABIE53_000586 in Paraburkholderia graminis OAS925

Annotation: dienelactone hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF02129: Peptidase_S15" amino acids 72 to 208 (137 residues), 45.9 bits, see alignment E=1.2e-15 PF12146: Hydrolase_4" amino acids 115 to 213 (99 residues), 30.2 bits, see alignment E=5.6e-11 PF01738: DLH" amino acids 116 to 272 (157 residues), 31.1 bits, see alignment E=3.5e-11 PF00326: Peptidase_S9" amino acids 120 to 196 (77 residues), 38.3 bits, see alignment E=2.1e-13

Best Hits

KEGG orthology group: None (inferred from 91% identity to bgf:BC1003_0198)

Predicted SEED Role

"Dienelactone hydrolase and related enzymes"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>ABIE53_000586 dienelactone hydrolase (Paraburkholderia graminis OAS925)
MALSKVLAKWAAMCAAAAAACAVAAAHATPLADAQPGPLARAHVPRIALPDDVYLPSARL
NEQIIRVPVDADGDVTLQTTIYKPDGPGPFPMIVFNHGKIPGDPRMQERSDPLPFAREFV
RRGYVVVAPNRQGFGQSGGVYQQDGCDVERNGMSQAGDVAATIDYMSKQPYVDATHIVVA
GTSHGGLATMAYGTEAAPGVRALINFSGGLRQDACGDWQGNLTRAFGAYGDKTKVPSLWM
YGDNDSVWNAPLVAGMHAAYVAHGASAKMVDYGTYKNDAHRLVGDRDGVHVWWPAVESFL
ARVGMPTGVQYRVSDPSAPKASGFASVDAVDAVPYVDEAGRNGYRNFLHQYPSRAFAVSD
TGAWSWAEGGDDPMSVAIANCQKQSSAPCRLYAVDNSVVWGDQGSRTADSGAGGSGSSVS
SSSVSSDGDVRPAIASRE