Protein Info for ABIE53_000567 in Paraburkholderia graminis OAS925

Annotation: Lrp/AsnC family leucine-responsive transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF13404: HTH_AsnC-type" amino acids 13 to 54 (42 residues), 60.1 bits, see alignment E=3.6e-20 PF13412: HTH_24" amino acids 13 to 60 (48 residues), 52.2 bits, see alignment E=9.2e-18 PF12840: HTH_20" amino acids 14 to 60 (47 residues), 27.6 bits, see alignment E=5.8e-10 PF09339: HTH_IclR" amino acids 19 to 61 (43 residues), 23.8 bits, see alignment E=7.8e-09 PF01037: AsnC_trans_reg" amino acids 79 to 145 (67 residues), 42.8 bits, see alignment E=9.7e-15

Best Hits

Swiss-Prot: 30% identical to REG7_PYRFU: HTH-type transcriptional regulator LrpA (lrpA) from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

KEGG orthology group: None (inferred from 92% identity to bug:BC1001_0158)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (156 amino acids)

>ABIE53_000567 Lrp/AsnC family leucine-responsive transcriptional regulator (Paraburkholderia graminis OAS925)
MTKRLTPLAPVPLDETDRALLAALAEDARRPVSELARLVGLSAPSTAERIRRLEAQGVIE
RFTVQLDPRALGFTLQAIVRVKPLPGQLHLVEEVIRRIPEFVECDKVTGDDCFICRLYLR
TIDQLDEILSKVTERAETSTAIVKSTPLARRLPPLG