Protein Info for ABIE53_000372 in Paraburkholderia graminis OAS925

Annotation: threonine/homoserine/homoserine lactone efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 41 to 59 (19 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details PF01810: LysE" amino acids 14 to 194 (181 residues), 81 bits, see alignment E=4.2e-27

Best Hits

KEGG orthology group: None (inferred from 89% identity to bgf:BC1003_0040)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (195 amino acids)

>ABIE53_000372 threonine/homoserine/homoserine lactone efflux protein (Paraburkholderia graminis OAS925)
MSALLSMAAFALASSISPGPVNVVALSAGAQHGFAASMRHVSGATVGFTVLLLLIGLGLH
ELLVHVPALVSIVKWAGVAFLLVMAYKLAVDDGQLGADKPSRGPSFAYGAAMQWLNPKAW
LASLAGMGAYAADGDGKLVWQFTVIYFVICYVSIASWAYAGTFLRKYLQAPQRVRLFNRV
MAALLAASALYLLVT