Protein Info for ABIE53_000338 in Paraburkholderia graminis OAS925

Annotation: chromosomal replication initiator protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 542 PF11638: DnaA_N" amino acids 2 to 66 (65 residues), 60.5 bits, see alignment E=2.7e-20 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 5 to 540 (536 residues), 557.6 bits, see alignment E=1.2e-171 PF00308: Bac_DnaA" amino acids 207 to 424 (218 residues), 285.7 bits, see alignment E=7.4e-89 PF01695: IstB_IS21" amino acids 243 to 344 (102 residues), 35.3 bits, see alignment E=2.3e-12 PF00004: AAA" amino acids 244 to 364 (121 residues), 29.3 bits, see alignment E=2.6e-10 PF08299: Bac_DnaA_C" amino acids 451 to 519 (69 residues), 110.3 bits, see alignment E=9.1e-36

Best Hits

Swiss-Prot: 96% identical to DNAA_PARXL: Chromosomal replication initiator protein DnaA (dnaA) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 97% identity to bpy:Bphyt_0001)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (542 amino acids)

>ABIE53_000338 chromosomal replication initiator protein (Paraburkholderia graminis OAS925)
MNEFWQHCSALLERELTPQQYVTWIKPLAPVAFDAAANTLSIAAPNRFKLDWVKSQFSGR
IADMARDFWQAPVDVQFVLDPKAGMRAPAAAAPAAARPASAPNSMGGSAGNAAAVDAAVG
AVQAAQATRANGPNSANSAMANLNANARAAAEHNANARAAAEDAADLDLPSLDANEAAAA
RRTWRPGQSASSNGNGENDSMYERSKLNPVLTFDNFVTGKANQLARAAAIQVADNPGISY
NPLFLYGGVGLGKTHLIHAIGNQLLMDKAGARIRYIHAEQYVSDVVKAYQRKAFDDFKRY
YHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISR
FDSGLTVAIEPPELEMRVAILMRKAQSEFVSLNEDVAFFVAKHLRSNVRELEGALRKILA
YSKFHGREITIELTKEALKDLLTVQNRQISVENIQKTVADFYSIKVADMYSKKRPANIAR
PRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQLNHELHVLEQTL
KG