Protein Info for ABIE53_000273 in Paraburkholderia graminis OAS925

Annotation: branched-chain amino acid transport system ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF00005: ABC_tran" amino acids 37 to 178 (142 residues), 92.9 bits, see alignment E=1.5e-30

Best Hits

KEGG orthology group: K01996, branched-chain amino acid transport system ATP-binding protein (inferred from 98% identity to bgf:BC1003_3468)

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivF (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>ABIE53_000273 branched-chain amino acid transport system ATP-binding protein (Paraburkholderia graminis OAS925)
MNTIAERESLEVSGKAAGAPALEITGLQAWYGESHILHGVDLTVDRGEVVTLLGRNGAGR
TTTLRAIMGLTGRRTGSIRIGGRETINLPTHRIAHCGIGYCPEERGIFSSLSCEENLLLP
PPVGDKAHMMSLEEIYSMFPNLQERRMSQGTRLSGGEQQMLAVARILRTGASLLLLDEIS
EGLAPVIVQALARMIVTLKARGYTIVMVEQNFRFAAPLADRFYVMEHGTIVEHFGASELE
SKMPVLHDLLGV