Protein Info for ABIE53_000153 in Paraburkholderia graminis OAS925

Annotation: O-antigen ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 48 to 82 (35 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 154 to 178 (25 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 225 to 242 (18 residues), see Phobius details amino acids 248 to 266 (19 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details amino acids 372 to 395 (24 residues), see Phobius details amino acids 407 to 426 (20 residues), see Phobius details amino acids 432 to 448 (17 residues), see Phobius details PF04932: Wzy_C" amino acids 231 to 388 (158 residues), 68.1 bits, see alignment E=4e-23

Best Hits

KEGG orthology group: None (inferred from 40% identity to bvi:Bcep1808_2399)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>ABIE53_000153 O-antigen ligase (Paraburkholderia graminis OAS925)
MDTAHNQQVACECRPAIAISARDEKRMNMKAMLSEKSLRPKTESYQLFLARTFALVTLCA
VPISTAGVNLGSGLVLLFALLSPEVWRACGKIRTSPTSIVALILFVALALSMAYTSASND
EAFNFLLKYRKLLLLPMLFLVFYGSDRSKWCRVAIWALFSALTLTMLLTYTNFFGWTAIG
PLHGNDPITKPWVFKDHISAGLMMAFLAYLSMALATASPKGIGQWLLRLVALLALVNVLF
VLQGRTGQVVAIAYMAVYVVVQLMKFKHQGKRTRWITTAASVMLCMCLVVYSFTAKNSRL
AETQQEITQFEVYNKNTSMGVRLEFYQRSLELILHRPIAGYGVGSVRTEFERLAKNSSGG
RAAMASNPHNEFFLMGVQLGMVGVALFAWLLIAIARESLRLDTLARTVVYGYLFAFVIGC
FANSLLLNFTEGNLFIFLIGILLASGPRREDTNGPAKETLSAAD