Protein Info for ABIE51_RS19105 in Lysobacter sp. OAE881

Annotation: pteridine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 10 to 191 (182 residues), 139.2 bits, E=2.4e-44
• PF01370: Epimerase
  • amino acids 11 to 80 (70 residues), 24 bits, E=4.7e-09
• PF08659: KR
  • amino acids 11 to 129 (119 residues), 31.5 bits, E=3.3e-11
• PF13561: adh_short_C2
  • amino acids 15 to 244 (230 residues), 174.8 bits, E=4.5e-55

Best Hits

KEGG orthology group: K03793, pteridine reductase [EC: 1.5.1.33] (inferred from 69% identity to xal:XALc_0833)

Predicted SEED Role

"FolM Alternative dihydrofolate reductase 1" in subsystem Folate Biosynthesis

MetaCyc Pathways

• folate transformations III (E. coli) (9/9 steps found)
• folate transformations II (plants) (10/11 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• tetrahydrofolate biosynthesis I (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• superpathway of chorismate metabolism (38/59 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.33

Protein Sequence (249 amino acids)

>ABIE51_RS19105 pteridine reductase (Lysobacter sp. OAE881)
MSTPRSAAPVALVTGAARRIGAAIVRRLHGAGYDIALHYRGSSDEANALAAELERARAGS
TVLLQADLAEFDRLPELIAQCVGRFGRLDALVNNASTFTPTPIGTATPAQWDALFASNAR
APFFLAQAAAPHLRASRGAIVNLADLYAERPLREHTLYCMAKAALLMMTRSLALELGPEV
RVNAVSPGAILWPENRSDTAAQQAMLARTPLARTGTPEEVAEAVRWLLQDAHYSTGQVLH
LDGGRLLAG