Protein Info for ABIE51_RS18140 in Lysobacter sp. OAE881

Annotation: YaiO family outer membrane beta-barrel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13432: TPR_16" amino acids 27 to 75 (49 residues), 26.1 bits, see alignment 4e-09 amino acids 69 to 123 (55 residues), 34.3 bits, see alignment 1.1e-11 PF13174: TPR_6" amino acids 57 to 88 (32 residues), 17.6 bits, see alignment (E = 1.9e-06) PF13428: TPR_14" amino acids 58 to 99 (42 residues), 26.9 bits, see alignment 2.1e-09 PF13176: TPR_7" amino acids 58 to 88 (31 residues), 15.1 bits, see alignment (E = 8.2e-06) PF14559: TPR_19" amino acids 70 to 132 (63 residues), 37 bits, see alignment E=1.4e-12 PF19413: YaiO" amino acids 166 to 335 (170 residues), 77.3 bits, see alignment E=6.2e-25 TIGR04390: outer membrane protein, YaiO family" amino acids 167 to 390 (224 residues), 140.6 bits, see alignment E=4e-45

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>ABIE51_RS18140 YaiO family outer membrane beta-barrel protein (Lysobacter sp. OAE881)
MRLRDAARLSVLGLAMTFCTANAQTVEQAQALVELRKYADAARVLEQRLAIAPDDADAMF
LLARTHAWNGEPTRALPLYERLLARAPDNVDYLLGYGQALGWAGRNEEAIEVLTRAQRLA
PDYADIGPALAQARAAQAAAISPEPLLPSPTDAPRAAAPQTPERRRTVSVSARHDWLDGA
YDDWSGVRVDASSSQRGRFGGYGAITADRRFDLDDVGIEAGALLPLGDTWLLQPEVGVVP
DADFLPRYYADLRVQNTFAHGWIGSASLRTSDYPDTRVDRLAVGVERYWSQWRAAYTFNL
TRLRDTHSPGHDVRLARAYGEGSEIGLQLAFGREAALVDTGVVASDVRGAVLFGRHVFAQ
RWSWLWNAGVVEQGDLYTRRGIGIGLERRF