Protein Info for ABIE51_RS17510 in Lysobacter sp. OAE881

Annotation: potassium channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 transmembrane" amino acids 21 to 37 (17 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 129 to 153 (25 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details amino acids 200 to 224 (25 residues), see Phobius details PF07885: Ion_trans_2" amino acids 138 to 219 (82 residues), 37.1 bits, see alignment E=1.2e-13

Best Hits

KEGG orthology group: None (inferred from 62% identity to sml:Smlt3908)

Predicted SEED Role

"FIG01111142: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>ABIE51_RS17510 potassium channel family protein (Lysobacter sp. OAE881)
MAENRIGLLRWRVQARRHPSAFLLAAQLLSLILYPIFDETRSSGRVLFGALGVVVLMLAV
WVVNRSPAKVWVAWLLAAPALGLSVLSVVLANDTLLVVSSALEALLYLYAASSLIAYMLG
DHRVTADELFAAGATFTLLAWGFAYAYFVCQAWYPGSFTGALRPGEPRTWLELLFLSFTT
LSATGLGDILPLSSPARVLVMLQQFAGVAYIAVVVSRLVGLTMLRATK