Protein Info for ABIE51_RS17455 in Lysobacter sp. OAE881

Annotation: adenylate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13671: AAA_33
  • amino acids 4 to 145 (142 residues), 34.7 bits, E=4.3e-12
• PF13238: AAA_18
  • amino acids 4 to 135 (132 residues), 29.7 bits, E=1.7e-10
• PF00406: ADK
  • amino acids 5 to 163 (159 residues), 187.1 bits, E=4.5e-59
• PF13207: AAA_17
  • amino acids 6 to 142 (137 residues), 113.9 bits, E=1.4e-36

Best Hits

Swiss-Prot: 75% identical to KAD_XANCP: Adenylate kinase (adk) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K00939, adenylate kinase [EC: 2.7.4.3] (inferred from 75% identity to xcb:XC_0873)

Predicted SEED Role

"Adenylate kinase (EC 2.7.4.3)" in subsystem Purine conversions (EC 2.7.4.3)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of purine nucleotide salvage (12/14 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)
• purine deoxyribonucleosides salvage (4/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.3

Protein Sequence (192 amino acids)

>ABIE51_RS17455 adenylate kinase (Lysobacter sp. OAE881)
MRLVLLGAPGSGKGTQAARLKDHLQVPHISTGDLLRAEVAAGSKLGLEAKEIMASGNLVS
DEILLGMLEDRFSRDDTKGGFILDGYPRNLAQAAALDQLLQRIGQPMDYAVQLEVPTEML
VERIAGRAKAEGRADDSPESVRRRLQVYNDQTAPVVDFYRQHGQLTVVNGVGSLDDVFTR
IVEALAPAKEVG