Protein Info for ABIE51_RS17425 in Lysobacter sp. OAE881

Annotation: ion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 38 to 57 (20 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 194 to 212 (19 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details PF00520: Ion_trans" amino acids 34 to 243 (210 residues), 122.7 bits, see alignment E=1.5e-39 PF07885: Ion_trans_2" amino acids 168 to 240 (73 residues), 54.4 bits, see alignment E=9.5e-19

Best Hits

KEGG orthology group: None (inferred from 70% identity to xca:xccb100_0901)

Predicted SEED Role

"Potassium voltage-gated channel subfamily KQT; possible potassium channel, VIC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>ABIE51_RS17425 ion transporter (Lysobacter sp. OAE881)
MPLLMDPQLQPATESGWRRHWFDIVFRHDTRRSRNFDLVLIAAILVSVVVIMLDSVARIH
ARHGELLHGLEWGFTLLFTAEYALRLAVLRNPWRYAISLWGLVDLASILPTYLSVLLPGS
QSLLALRILRMLRLFRILKLTHYVEEGGVLVGALWRSRRKIFVFVCAVMTITVIFGALMY
VVEGPEHGFSSIPTSMYWAVVTMATVGFGDIAPQTTLGRFITSLLILIGYSIIAVPTGIY
TAELASSLREASGDASRLDRRGCTGCGLEGHDPAAHFCRHCGTTLPSATG