Protein Info for ABIE51_RS17365 in Lysobacter sp. OAE881

Annotation: ribose-5-phosphate isomerase RpiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00021: ribose 5-phosphate isomerase A
  • amino acids 5 to 214 (210 residues), 233.2 bits, E=1.2e-73
• PF06026: Rib_5-P_isom_A
  • amino acids 47 to 215 (169 residues), 206.5 bits, E=1.2e-65

Best Hits

Swiss-Prot: 82% identical to RPIA_XANAC: Ribose-5-phosphate isomerase A (rpiA) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K01807, ribose 5-phosphate isomerase A [EC: 5.3.1.6] (inferred from 82% identity to xac:XAC3411)

MetaCyc: 63% identical to ribose-5-phosphate isomerase A (Escherichia coli K-12 substr. MG1655)
Ribose-5-phosphate isomerase. [EC: 5.3.1.6]

Predicted SEED Role

"Ribose 5-phosphate isomerase A (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or Pentose phosphate pathway (EC 5.3.1.6)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• pentose phosphate pathway (8/8 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• Bifidobacterium shunt (12/15 steps found)
• Rubisco shunt (8/10 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
• Calvin-Benson-Bassham cycle (9/13 steps found)
• ethene biosynthesis V (engineered) (17/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (17/26 steps found)
• oxygenic photosynthesis (10/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Carbon fixation in photosynthetic organisms
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.6

Protein Sequence (220 amino acids)

>ABIE51_RS17365 ribose-5-phosphate isomerase RpiA (Lysobacter sp. OAE881)
MSESKRLAGEKAIEYVEDGMIVGVGTGSTVAFFIDALARIKDRIKGAVSSSDQSTARLRQ
HGIEVLDLNATGPLSLYVDGADECDPHKRLIKGGGAALTREKIIAEASQKFVCIVDPSKR
VDVLGKFPLPVEVIPMARSLVAREIQAMTRGQPVWRQTADGAGVVTDNGNVILDIHGLAI
VDPVGLEQAINQIPGVVSVGLFARRPADVVIVGGEPPIVL