Protein Info for ABIE51_RS17140 in Lysobacter sp. OAE881

Annotation: VWA domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 577 transmembrane" amino acids 18 to 35 (18 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 308 to 339 (32 residues), see Phobius details PF13519: VWA_2" amino acids 101 to 207 (107 residues), 39.2 bits, see alignment E=3.3e-13 PF13432: TPR_16" amino acids 358 to 416 (59 residues), 34.9 bits, see alignment 6.4e-12 PF00515: TPR_1" amino acids 382 to 414 (33 residues), 38.9 bits, see alignment (E = 1.8e-13) PF07719: TPR_2" amino acids 382 to 414 (33 residues), 33.2 bits, see alignment (E = 1.1e-11)

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 55% identity to xac:XAC3375)

Predicted SEED Role

"TPR domain protein in aerotolerance operon"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (577 amino acids)

>ABIE51_RS17140 VWA domain-containing protein (Lysobacter sp. OAE881)
MNPFADLSLASLHLLRPQWLWALLALPVLLGLWRVRRRRASVWRENVDAHLLPHLLVERG
GARVRWGAWVAGLAYVLAVFALAGPSWRQTPQPLWQSRTPLVVAVDLSGAALAADLPPSR
LAQSRAKLSTLLRERQGGQVALVAFADDAFTVAPLTEDAANVALFLDALSPDVMPVDGQR
ADRAIESSVQLLKQSGFDRGRILLMTDHAGDGANDAASAAAKQGFRVDVLGVGAEAGAPY
RRGDGTFANARLDEGSLRGLASAGNGRYARIASDDGDLRALGVLDPTDTEDATRVDGKRG
SAWQDEGYWLLPPLMLLALFAFRRRAALAMIAMCVLWTPVKAADLWRRADQIEHAHIAQG
NEAFRRGDFNAAAQAYQSADSADAHYNRGNALAKAGQYPQAIAAYDEALKRQPDMPDAIA
NKRAVQAAMKRKPPQGGGGQSKDQDKSKSDQKPQSGQGQQGPQSQQDKSQQSEPQPRDSQ
KQDPADKPSSEGSPADAQKQREADAAQRERMQRALQQQGQAKPPQDAPSRNETPQQREQR
LANEAWLRRVPDDPGGLLREKFRIEYERRNNSGEGNE