Protein Info for ABIE51_RS16860 in Lysobacter sp. OAE881

Annotation: MinD/ParA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 PF13614: AAA_31" amino acids 22 to 176 (155 residues), 46.6 bits, see alignment E=9.9e-16 PF10609: ParA" amino acids 22 to 73 (52 residues), 48.1 bits, see alignment 2.7e-16 PF01656: CbiA" amino acids 24 to 239 (216 residues), 61.3 bits, see alignment E=2.3e-20 PF02374: ArsA_ATPase" amino acids 26 to 59 (34 residues), 29.3 bits, see alignment 1.3e-10

Best Hits

KEGG orthology group: K04562, flagellar biosynthesis protein FlhG (inferred from 63% identity to xcc:XCC1907)

Predicted SEED Role

"Flagellar synthesis regulator FleN" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>ABIE51_RS16860 MinD/ParA family protein (Lysobacter sp. OAE881)
MHSPADINAIPAANGTARPPVRVIAVASGKGGVGKTSVSVNLAMALVHAGQRTLLLDTDL
GLANVDVMLGLSPQFTLADVFAGRCELQDTLLEGPRGLWVVPAASGKRHMTELLPQQHIG
LVHAFCQLDLPLDAMVVDNAAGISDSVLTFCQAAQDVIVVVCDEPASVTDAYALIKVLSR
ERGVTRVQVLANQVNNAIEGKQLFEKLERVSARFLDVTLHYLGAVPRDEWLRRAIQRQEA
VVEAFPGCPSALAFRDIARRANSWQSPVGPRGGVEFFMERLVAHGASAASTNDPLRSAVA