Protein Info for ABIE51_RS15860 in Lysobacter sp. OAE881

Annotation: cysteine synthase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 54% identical to CYSK_BACSU: Cysteine synthase (cysK) from Bacillus subtilis (strain 168)

KEGG orthology group: K01738, cysteine synthase A [EC: 2.5.1.47] (inferred from 80% identity to psu:Psesu_0459)

MetaCyc: 48% identical to cysteine synthase A (Escherichia coli K-12 substr. MG1655)
Cystathionine gamma-lyase. [EC: 4.4.1.1, 4.4.1.28]; Cysteine synthase. [EC: 4.4.1.1, 4.4.1.28, 2.5.1.47]

Predicted SEED Role

"Cysteine synthase (EC 2.5.1.47)" in subsystem Cysteine Biosynthesis or Methionine Biosynthesis (EC 2.5.1.47)

MetaCyc Pathways

superpathway of branched chain amino acid biosynthesis (17/17 steps found)
superpathway of L-isoleucine biosynthesis I (13/13 steps found)
superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
D-serine degradation (3/3 steps found)
L-cysteine degradation II (3/3 steps found)
L-serine degradation (3/3 steps found)
superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
L-cysteine biosynthesis I (2/2 steps found)
L-cysteine biosynthesis III (from L-homocysteine) (2/2 steps found)
superpathway of L-cysteine biosynthesis (mammalian) (4/5 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (11/15 steps found)
homocysteine and cysteine interconversion (3/4 steps found)
L-methionine degradation II (2/3 steps found)
L-tryptophan degradation II (via pyruvate) (2/3 steps found)
L-methionine biosynthesis II (4/6 steps found)
hydrogen sulfide biosynthesis II (mammalian) (4/6 steps found)
superpathway of L-cysteine biosynthesis (fungi) (4/6 steps found)
superpathway of L-threonine metabolism (12/18 steps found)
glycine betaine degradation III (4/7 steps found)
L-threonine degradation I (3/6 steps found)
felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
seleno-amino acid biosynthesis (plants) (2/5 steps found)
L-mimosine degradation (4/8 steps found)
glycine betaine degradation I (4/8 steps found)
L-cysteine biosynthesis VI (reverse transsulfuration) (3/7 steps found)
purine nucleobases degradation II (anaerobic) (15/24 steps found)
glutathione-mediated detoxification I (3/8 steps found)
superpathway of L-methionine salvage and degradation (8/16 steps found)
hypoglycin biosynthesis (4/14 steps found)
superpathway of seleno-compound metabolism (5/19 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.47, 4.4.1.1

Use Curated BLAST to search for 2.5.1.47 or 4.4.1.1 or 4.4.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>ABIE51_RS15860 cysteine synthase A (Lysobacter sp. OAE881)
MALYDSILDTIGSTPIVKLHRIAPKHVTLYAKVESFNPGGSVKDRLALAIVLDAERKGLL
KPGQTIVEATSGNTGIALALVAAARGYPFVAVMTETFSVERRKLMRAYGAKVILTPAAER
GTGMVRRAKELAEKHGWFLARQFENEANPAYHRSTTGPEILRDFAGKRLDYFVSGWGTGG
TITGAGEVLKLARPDLKVIASEPAGAALLSGKEWQPHKIQGWTPDFLPAVLSRTVADEVL
PVDEVLARDTARRLAAEEGLFVGISAGATVAAALKVAESAPEGSVLLAVLPDTGERYLST
FLFEGVSEGSDDEWLESLERDAVAA