Protein Info for ABIE51_RS15405 in Lysobacter sp. OAE881

Annotation: carboxylating nicotinate-nucleotide diphosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00078: nicotinate-nucleotide diphosphorylase (carboxylating)
  • amino acids 16 to 282 (267 residues), 280.8 bits, E=4.9e-88
• PF02749: QRPTase_N
  • amino acids 25 to 111 (87 residues), 74.6 bits, E=5.1e-25
• PF01729: QRPTase_C
  • amino acids 114 to 282 (169 residues), 180.8 bits, E=1.9e-57

Best Hits

KEGG orthology group: K00767, nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC: 2.4.2.19] (inferred from 77% identity to xcv:XCV2831)

Predicted SEED Role

"Quinolinate phosphoribosyltransferase [decarboxylating] (EC 2.4.2.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.4.2.19)

MetaCyc Pathways

• NAD de novo biosynthesis II (from tryptophan) (9/9 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
• aspartate superpathway (19/25 steps found)
• NAD de novo biosynthesis I (4/6 steps found)
• NAD de novo biosynthesis III (4/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (4/6 steps found)
• superpathway of NAD biosynthesis in eukaryotes (9/14 steps found)
• nicotine biosynthesis (1/9 steps found)
• superpathway of nicotine biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.19

Protein Sequence (288 amino acids)

>ABIE51_RS15405 carboxylating nicotinate-nucleotide diphosphorylase (Lysobacter sp. OAE881)
MSTFAPPPAEVVAHDVALALAEDLGSGDVTSALLPDVADDAYLLCKEDAVVCGRPWFDAC
HRALDPHVRIDWRVAEGDRVKAGTVLATLHGRARALVSAERASLNFMQTLSATATTTAAY
VEAVRGTAARILDTRKTIPGLRQAQKYAVRVGGGVNHRIGLFDAVMLKENHVRAAGSITA
AIRAARAMHPSLPLIVEVESIEQLREALHEGCDRILIDDFDASMRREAVRIAHEVPADER
IPLEVSGGVDMQTLRGIAEDGVDCISIGGLTKHVRAIDLSLKLGPPPA