Protein Info for ABIE51_RS15385 in Lysobacter sp. OAE881

Annotation: Fe-Mn family superoxide dismutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00081: Sod_Fe_N
  • amino acids 4 to 82 (79 residues), 112.5 bits, E=1.1e-36
• PF02777: Sod_Fe_C
  • amino acids 89 to 189 (101 residues), 137.7 bits, E=1.3e-44

Best Hits

Swiss-Prot: 76% identical to SODF_PSEAE: Superoxide dismutase [Fe] (sodB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 77% identity to pmy:Pmen_3322)

MetaCyc: 68% identical to superoxide dismutase (Fe) (Burkholderia sp. AK-5)
Superoxide dismutase. [EC: 1.15.1.1]

Predicted SEED Role

"Superoxide dismutase [Fe] (EC 1.15.1.1)" in subsystem Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• ethene biosynthesis III (microbes) (6/7 steps found)
• superoxide radicals degradation (2/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.15.1.1

Use Curated BLAST to search for 1.15.1.1

Protein Sequence (192 amino acids)

>ABIE51_RS15385 Fe-Mn family superoxide dismutase (Lysobacter sp. OAE881)
MAIELPPLPYDRTALEPHISAETLDYHHGKHHKTYVDNLNKMIEGTEFEQLSLVEIIRKS
QGGMFNNAAQVWNHTFYWNCLSPKGGGEPTGKVAELINKAFGDFAKFKDEFSKLSIGTFG
SGWGWLVQRPDGSLALVSTSNANTPITGEDTPLLTCDVWEHAYYIDYRNARPKYVEAFWN
LVNWDFVASNLK