Protein Info for ABIE51_RS14930 in Lysobacter sp. OAE881

Annotation: ATP-dependent RNA helicase DbpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 PF04851: ResIII" amino acids 34 to 198 (165 residues), 37.7 bits, see alignment E=3.9e-13 PF00270: DEAD" amino acids 36 to 203 (168 residues), 168.3 bits, see alignment E=2.6e-53 PF00271: Helicase_C" amino acids 238 to 346 (109 residues), 105.8 bits, see alignment E=3e-34 PF03880: DbpA" amino acids 396 to 466 (71 residues), 85.7 bits, see alignment E=3.6e-28

Best Hits

KEGG orthology group: K05591, ATP-independent RNA helicase DbpA [EC: 3.6.4.13] (inferred from 67% identity to xca:xccb100_1896)

Predicted SEED Role

"ATP-dependent 23S rRNA helicase DbpA"

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.13

Use Curated BLAST to search for 3.6.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (468 amino acids)

>ABIE51_RS14930 ATP-dependent RNA helicase DbpA (Lysobacter sp. OAE881)
MTDSPDTAAPAAAFDRLPLTPALLQGVQALGYTQMTPVQAQALPAILDGRDLIAQAPTGS
GKTAAFGLGLLHRLDPASTATQALVLCPTRELADQVGRQLRKLAFAIPNLKLSILCGGMP
LQPQLDSLAQHAPQIVVGTPGRLQELLRKRALDLKNVRTLVFDEADRMLDMGFEEPIREI
VRATPASRQGLLFSATFPDAVREISRAMLRDPVEVTVEGGERHAAIEQRFYEVDPARKVQ
LLAALLLQEKPESCVVFCNMRRDVDEVAGSLSHYGFTALALHGDMEQRDRDEVFVQFANR
SCNVLVASDVAARGLDVKELAMVVNFDVPSDADTYVHRIGRTGRAGRDGLALTLVGPREQ
GRVSAIEERQDAPLDWFKATPLSGKPNNVPPAAMVTLRIDAGRTDKLRPGDILGALTGDA
GLKADSVGKIDVFPTRSYVAVARGQATHALSRLREGKIKGRKFRVNRM