Protein Info for ABIE51_RS14595 in Lysobacter sp. OAE881

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 76 to 93 (18 residues), see Phobius details amino acids 99 to 115 (17 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details PF07730: HisKA_3" amino acids 199 to 261 (63 residues), 58.6 bits, see alignment E=7.2e-20 PF02518: HATPase_c" amino acids 301 to 384 (84 residues), 30.8 bits, see alignment E=3.4e-11

Best Hits

KEGG orthology group: None (inferred from 65% identity to xcb:XC_3118)

Predicted SEED Role

"two-component system sensor protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (397 amino acids)

>ABIE51_RS14595 sensor histidine kinase (Lysobacter sp. OAE881)
MLARLNHTRLLRYAGLFTWGAVGLWLLSVWFDPTILSPDTEGPPALQILRWLVVYLAFGL
IYWWISRQLGRPSGALDKVLLLVLTGCAIGVGYFSRTGLGSILLMVVAGLLPWLMPVRWG
LALLVGGNVAIIPLFVEALDFPPMVAVLQSVTYMGFSSLVFVTALVARQQAEAREEQRRL
NAELRATRALLGESVRVNERTRISRELHDLLGHHLTALSLNLEVAGHLSEGRVKEHVQQA
HTLARLLLTDVREAVSQLREGGAIDLSAALLPLAENVPALDIHMDIQAPLTLDDPERAHV
LLRCTQEIITNAVRHAGARNLWINAGRRSDCIVMSARDDGNGSDNLVAGNGLRGMRERLQ
AHGGDLKIETRLGAGFCLHLTLPASAAAAAACEGAIA