Protein Info for ABIE51_RS14505 in Lysobacter sp. OAE881

Annotation: EF-hand domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13202: EF-hand_5" amino acids 33 to 47 (15 residues), 15.7 bits, see alignment (E = 2.5e-06) amino acids 55 to 73 (19 residues), 21.8 bits, see alignment (E = 2.9e-08) amino acids 94 to 107 (14 residues), 15.1 bits, see alignment (E = 3.8e-06) amino acids 118 to 135 (18 residues), 12.8 bits, see alignment (E = 2.1e-05) amino acids 156 to 170 (15 residues), 15.7 bits, see alignment (E = 2.5e-06) PF13499: EF-hand_7" amino acids 114 to 174 (61 residues), 31.4 bits, see alignment E=6e-11

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (205 amino acids)

>ABIE51_RS14505 EF-hand domain-containing protein (Lysobacter sp. OAE881)
MTRTTLSVLLATAVAATVAGAAIAAPQSGATRQKIDLNNDGVIDRTEAAAHPRLAASFDQ
LDKNRDGKLDASERPHHRKGGHGRHGGGMDRIVKADADGDGRISRTEAGSLRFIGEKFAE
IDSNRDGYIVRSELTRYHERMRPQHEAERAKRAEERFAAADLNKDGKLSRVEVSEKMPRL
EKSFAFMDEDRDGFLTRADLAPPKR