Protein Info for ABIE51_RS13535 in Lysobacter sp. OAE881

Annotation: M48 family metallopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details PF01435: Peptidase_M48" amino acids 122 to 289 (168 residues), 127.7 bits, see alignment E=2.4e-41

Best Hits

KEGG orthology group: None (inferred from 58% identity to sml:Smlt3336)

Predicted SEED Role

"Zn-dependent protease with chaperone function PA4632"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>ABIE51_RS13535 M48 family metallopeptidase (Lysobacter sp. OAE881)
MRTDPFGGARQQGRPRRGFGGIRWWILILFAGYAAWQWFGNARVDPYTGEKAHYGTTADE
EVQLGAQAFQQVLGDANAQGALLPPDSQASVQIRQIAERLIQRVPEVTATLAAQNQQQTP
TDHQQFQWDVAVIQSDQANAFCLPGGKMAVYTGLIPIAQNADAMAVVMGHEIAHALLRHG
SQRMAQQKLVQMGQMAAGMAIGGMDPQQQQAVMAALGAGAQYGFILPYGRNHETQADKVG
LMLAAAACYDPHAAIPLWERMSELGGGERPPEFASTHPDPANRIQVLQSLMPQAEQFRAQ
FCGAGAKAATAAR