Protein Info for ABIE51_RS13210 in Lysobacter sp. OAE881

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 855 TIGR00229: PAS domain S-box protein" amino acids 58 to 176 (119 residues), 46 bits, see alignment E=5.3e-16 amino acids 176 to 302 (127 residues), 25.9 bits, see alignment E=9.1e-10 PF00989: PAS" amino acids 62 to 168 (107 residues), 23.6 bits, see alignment E=1.6e-08 PF08448: PAS_4" amino acids 67 to 173 (107 residues), 23.8 bits, see alignment E=1.6e-08 amino acids 185 to 302 (118 residues), 25 bits, see alignment E=6.5e-09 PF13426: PAS_9" amino acids 71 to 170 (100 residues), 42.4 bits, see alignment E=2.6e-14 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 426 to 586 (161 residues), 116.3 bits, see alignment E=1.2e-37 PF00990: GGDEF" amino acids 430 to 583 (154 residues), 129.6 bits, see alignment E=3.3e-41 PF00563: EAL" amino acids 605 to 838 (234 residues), 218.3 bits, see alignment E=3.6e-68

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (855 amino acids)

>ABIE51_RS13210 EAL domain-containing protein (Lysobacter sp. OAE881)
MKPRSPAQDTAPPLPVDAKTTLAALQDAARDSALPAPTRELLLQAHQALAQSLADCEAER
ARYRTLFDAVPDPVSIIAWDGTVLDLNKAGMNAYRRAREEIVGQPIETLNPDLPQDHMVP
VWETLNRGGTYVVEVTNMRGDGTRFPVEVHTAGLTFDGRKAMVAVARDLSSRHTAELRYR
ELMEAIDRGIVVQDAELQITYANVAAMKILGVGEDELVNDAMRGEQWLVMDEHGRQLASD
RYPSARALQSGRIIESTVVGLYHRQRQQLMWLSVTAVPQFPAGGDKPQQVLSLFSDITAL
KRDSTLFDRAQSMAHIGGWEWEVTPDRLYLTEEAQRILGHRPAPDTIEGMLDCLRVDDRD
RLRAALGQAISFGRNLDLEVQGHRADGRTFWARVIGEAEAGDPLHSRLTGTLQDVTERKH
DEETLRVQARSDPLTGLLNRDAVLAELESRLDDPLRSQLAVLYVDLDRFKVVNDVLGHAA
GDRLLASAARRIQRAIGNEGLIARFGGDEFLILCDTGSDPSRPERLADAILEIFGDSFRL
DGEEFSITASIGIAQAPLDGVRSQQLIQSADVAMYDSKRRGRNGWQTFTPELAEQQLHRL
QLETHLRRAVNNEEFHLVYQPQIDMRNGDVVAAEALIRWRNHSLGEIRPDKFIDHAETTG
DIVGIGDWVLNEACRQMREWQDSGLNIPRVAVNVSYRQFLGEDLASTVAAVLAEYGLPGH
ALELEFTERVLIEDAPDTLRTFAALRHLGVILTIDDFGEGYSALNYLRRLPIHGLKLSQL
FVQGVPDNQSDVAVCQAVTGIARSLGLALVAEGVETGQHRDFLLQLGVHVGQGFLFAPGM
TPEELRERYPTVGMA