Protein Info for ABIE51_RS12670 in Lysobacter sp. OAE881

Annotation: 3-hydroxyanthranilate 3,4-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06052: 3-HAO
  • amino acids 5 to 150 (146 residues), 231.2 bits, E=5.9e-73
• TIGR03037: 3-hydroxyanthranilate 3,4-dioxygenase
  • amino acids 6 to 163 (158 residues), 253.6 bits, E=3.8e-80
• PF02311: AraC_binding
  • amino acids 35 to 93 (59 residues), 27 bits, E=4.9e-10
• PF07883: Cupin_2
  • amino acids 41 to 94 (54 residues), 30.8 bits, E=2.8e-11

Best Hits

Swiss-Prot: 75% identical to 3HAO_XANAC: 3-hydroxyanthranilate 3,4-dioxygenase (nbaC) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K00452, 3-hydroxyanthranilate 3,4-dioxygenase [EC: 1.13.11.6] (inferred from 73% identity to xal:XALc_1752)

MetaCyc: 47% identical to 3-hydroxyanthranilate 3,4-dioxygenase (Geobacillus thermodenitrificans NG80-2)
3-hydroxyanthranilate 3,4-dioxygenase. [EC: 1.13.11.6]

Predicted SEED Role

"3-hydroxyanthranilate 3,4-dioxygenase (EC 1.13.11.6)" in subsystem NAD and NADP cofactor biosynthesis global or Quinolinic acid and its derivatives (EC 1.13.11.6)

MetaCyc Pathways

• NAD de novo biosynthesis II (from tryptophan) (9/9 steps found)
• L-tryptophan degradation to 2-amino-3-carboxymuconate semialdehyde (5/5 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
• L-tryptophan degradation IX (9/12 steps found)
• L-tryptophan degradation III (eukaryotic) (11/15 steps found)
• L-tryptophan degradation XII (Geobacillus) (8/12 steps found)
• 2-nitrobenzoate degradation I (4/7 steps found)
• superpathway of NAD biosynthesis in eukaryotes (9/14 steps found)
• L-tryptophan degradation XI (mammalian, via kynurenine) (12/23 steps found)

KEGG Metabolic Maps

• Tryptophan metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.6

Protein Sequence (176 amino acids)

>ABIE51_RS12670 3-hydroxyanthranilate 3,4-dioxygenase (Lysobacter sp. OAE881)
MLPGPINLHAWIEEHRHLLKPPVGNKVIYVGDFIVMVVGGPNQRTDYHFDEGAEWFYQLE
GEMILRIQEDGQARDIPIRAGEIFLLPPRVPHSPQRLPDSIGLVIERRRRPEELDGLMWF
CERCNHKLYEEFFPLRNIETDFPPVFDRFYASRDHRTCGQCGHVNPAPSKYVMPDT