Protein Info for ABIE51_RS12145 in Lysobacter sp. OAE881

Annotation: prephenate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01807: chorismate mutase
  • amino acids 47 to 122 (76 residues), 86.6 bits, E=5.5e-29
• PF01817: CM_2
  • amino acids 51 to 130 (80 residues), 68.4 bits, E=8.6e-23
• PF00800: PDT
  • amino acids 134 to 309 (176 residues), 216.7 bits, E=3.5e-68
• PF01842: ACT
  • amino acids 319 to 384 (66 residues), 40.9 bits, E=2.1e-14

Best Hits

Swiss-Prot: 51% identical to CMPDT_PSEST: Bifunctional chorismate mutase/prephenate dehydratase (pheA) from Pseudomonas stutzeri

KEGG orthology group: K14170, chorismate mutase / prephenate dehydratase [EC: 4.2.1.51 5.4.99.5] (inferred from 72% identity to psu:Psesu_1719)

Predicted SEED Role

"Chorismate mutase I (EC 5.4.99.5) / Prephenate dehydratase (EC 4.2.1.51)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 4.2.1.51, EC 5.4.99.5)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (16/18 steps found)
• superpathway of L-phenylalanine biosynthesis (9/10 steps found)
• L-phenylalanine biosynthesis I (3/3 steps found)
• superpathway of L-tyrosine biosynthesis (8/10 steps found)
• L-tyrosine biosynthesis I (2/3 steps found)
• L-phenylalanine biosynthesis III (cytosolic, plants) (1/2 steps found)
• L-phenylalanine biosynthesis II (1/4 steps found)
• L-tyrosine biosynthesis II (1/4 steps found)
• L-tyrosine biosynthesis III (1/4 steps found)
• superpathway of L-phenylalanine and L-tyrosine biosynthesis (1/5 steps found)
• superpathway of chorismate metabolism (38/59 steps found)
• bacilysin biosynthesis (1/10 steps found)
• salinosporamide A biosynthesis (3/15 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.51 or 5.4.99.5

Protein Sequence (401 amino acids)

>ABIE51_RS12145 prephenate dehydratase (Lysobacter sp. OAE881)
MKKTGKAAPKKQTTTKAATKRAPSKRAPAKDVADAVPSKTDAAPLDLATLRERIDGIDRH
IQELIGERAQFANQVGKAKGKLAAAVDYYRPEREAQVLRRVVDRNDGPLNDEVLVRLFRE
IMSACLAQQEPLKIGYLGPEGTHSQQAVYKHFGHSIHGLPLASIEEVFQEVEAGHADFGV
VPVENSTQGTIQSTLDMFLTSKLKICGEVELRVHQHLLSRNDQLEGIERVYSHPQSFAQC
KAWLRQYLPKAEKIPVSSNAEAARRARASDDAAAIAGISAANVYGLKSVAGPIEDRPDNT
TRFLVIGRELFPPSGNDRTSLMIFIKDQPGALYHVLAPFAKHGLSMNRIESRPGHTGLWQ
YAFFIDIGGHVQEEAMRRALDELADYAQEVKVLGSYPVAIA