Protein Info for ABIE51_RS11880 in Lysobacter sp. OAE881

Annotation: SulP family inorganic anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 transmembrane" amino acids 19 to 61 (43 residues), see Phobius details amino acids 68 to 80 (13 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details amino acids 319 to 338 (20 residues), see Phobius details amino acids 344 to 363 (20 residues), see Phobius details amino acids 375 to 404 (30 residues), see Phobius details PF00916: Sulfate_transp" amino acids 14 to 379 (366 residues), 307 bits, see alignment E=2.5e-95 PF01740: STAS" amino acids 433 to 527 (95 residues), 63.6 bits, see alignment E=1.9e-21 PF13466: STAS_2" amino acids 444 to 522 (79 residues), 38.4 bits, see alignment E=1.7e-13

Best Hits

KEGG orthology group: None (inferred from 64% identity to bph:Bphy_2397)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (558 amino acids)

>ABIE51_RS11880 SulP family inorganic anion transporter (Lysobacter sp. OAE881)
MAVAESPVPGTRPLRGDVVAGLTAAAVVIPKAIAYATIAGLPIEVGLYTAFVPMLVYVLL
GTSRPLSVSTTTTIAILTGAELSMIVPDADPARLITVTATLTLMVGAILIAASLLRLGFV
ANFISLPVLVGFKAGIGVVIIVDQLPKLLGLHFDKGSFLHNIGEVVRGLGHLSWPTLAVG
LGTIALLTLIERFRPQWPAPLIAVAAAIAGAGLLGWQAHGIDLVGTVPSGFPHLTMPDLD
LVEQLWPGACGIALMSFTETIAVGRAFQAPHEPLPRANRELLATGAGNAVSAFFGAMPSG
GGMSQTAVNRRAGARSQMAQVFTAGATVATMLLLAPLIGLMPHATLAALVIVYSIGLIHP
ADFRDILRVRRTEFLWALAAFAGVMLLGTLKGILVAIVVSLVALAQQAADPPVRVLGRKR
GTNVFRPPSPEHPDDETFPGLLLLKLEGRLFFMNAERVADKIRPLIAQHRPRYVVIDMSG
LFDLEYSALNALVEAERRYRAAGVQLVLAELNPEVYAMVQRSPLGQVLGEERMLFNLEVA
VARLQAAAAAPRHAESPT