Protein Info for ABIE51_RS11055 in Lysobacter sp. OAE881

Annotation: CDF family Co(II)/Ni(II) efflux transporter DmeF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 30 to 48 (19 residues), see Phobius details amino acids 60 to 77 (18 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 192 to 217 (26 residues), see Phobius details amino acids 223 to 241 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 24 to 323 (300 residues), 222.7 bits, see alignment E=3e-70 PF01545: Cation_efflux" amino acids 30 to 249 (220 residues), 119.2 bits, see alignment E=9.8e-39

Best Hits

KEGG orthology group: None (inferred from 73% identity to smt:Smal_0396)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>ABIE51_RS11055 CDF family Co(II)/Ni(II) efflux transporter DmeF (Lysobacter sp. OAE881)
MNLDAIADSRRHSHAFDQGNPLAERNTRRAMWLTLAMMVIEITGGWWFNSMAVLADGWHM
SSHALALGLSAFAYACARRYAGDRRFAFGTWKIEILGGYTSAIALMGVAALMAFQSVERL
FNPSAIHYEQAIAIAVVGLAVNLLCAWWLRDHHPHGHDHHDHHHGHDDHHHGDHHGHHHG
HHHHHDLNQRSAYLHVIADAATSVLAIVALLGGMMFGAAWLDPVMGLVGAALVAGWAWGL
VRDSGRILLDAQMDAPVVEEIREAIEEGDVRARISDLHVWQVGRGKYACTAEVVTDAPVE
PDVFHKALSVHEEIVHVTIEVRHATR