Protein Info for ABIE51_RS11025 in Lysobacter sp. OAE881

Annotation: aldehyde dehydrogenase iron-sulfur subunit PaoA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 65 to 116 (52 residues), 40.9 bits, E=1.6e-14
• PF01799: Fer2_2
  • amino acids 133 to 220 (88 residues), 98.6 bits, E=1.8e-32

Best Hits

Swiss-Prot: 60% identical to PAOA_ECO57: Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA (paoA) from Escherichia coli O157:H7

KEGG orthology group: K13483, xanthine dehydrogenase YagT iron-sulfur-binding subunit (inferred from 72% identity to xac:XAC2895)

MetaCyc: 60% identical to aldehyde dehydrogenase, Fe-S subunit (Escherichia coli K-12 substr. MG1655)
Carboxylate reductase. [EC: 1.2.99.6]; 1.2.98.- [EC: 1.2.99.6]; 1.2.98.- [EC: 1.2.99.6]

Predicted SEED Role

"Periplasmic aromatic aldehyde oxidoreductase, iron-sulfur subunit YagT"

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.99.6

Protein Sequence (228 amino acids)

>ABIE51_RS11025 aldehyde dehydrogenase iron-sulfur subunit PaoA (Lysobacter sp. OAE881)
MDKESPLDPRGLDINPLETRVSRRKVLIAGTVTAASGALPAMATLANEATAPAEARPVVM
SKVTFEVNGQSRSLELDTRTTLLDALREHLRLTGTKKGCDHGQCGACTVIVDGRRINSCL
TLAVMNEGAKITTIEGLGTPQSLHPMQAAFVKHDGYQCGYCTPGQICSAVAMLDEVKAGI
PSHVTGDLTARTRLSVDEARERMSGNICRCGAYSNIMDAIGDVAGGLA