Protein Info for ABIE51_RS11010 in Lysobacter sp. OAE881

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 25 to 49 (25 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 179 to 203 (25 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 313 to 336 (24 residues), see Phobius details amino acids 348 to 368 (21 residues), see Phobius details amino acids 375 to 393 (19 residues), see Phobius details PF07690: MFS_1" amino acids 31 to 361 (331 residues), 143.1 bits, see alignment E=5.3e-46

Best Hits

KEGG orthology group: None (inferred from 70% identity to hse:Hsero_1072)

Predicted SEED Role

"FIG00725189: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>ABIE51_RS11010 MFS transporter (Lysobacter sp. OAE881)
MSSTECSVPDGDAAPEASPDAAHWPAVASLTLGVFGLVTAEFLPASLLTAMAADLRISEG
AAGQTVTATALIGAIAAPSIPVLTRRMDRRRVMLALTLALLLSNTIAVFASSLTTLLVAR
VLLGVALGGFWSMAAPLALRLVPESLFPRAMSLILTGVSVATVCAAPIGAWMGDAWGWRS
AFVAAGAVGVVTLVAQWLTLPALPPKTQPDLRVLAELVTRGPVRAALVVVLLVISGHFAG
FTYIRPLMENVTHLSIGAVSAVLMGYGIGGFFGNLAGGYVAGRSERHAIVLGSVAIAALA
VALLIAGHSAGVASVAIVLWGFAFGAFPVGFQIWIVRAAPDQAEGASGLLVAAFQTAIAT
GAIGGGVLVDRIGALGGPLFAVVAMTLGAMLTLRYGPRGSTPLAVTASH