Protein Info for ABIE51_RS10935 in Lysobacter sp. OAE881

Annotation: galactonate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 PF02746: MR_MLE_N" amino acids 8 to 120 (113 residues), 89 bits, see alignment E=2.6e-29 PF13378: MR_MLE_C" amino acids 141 to 368 (228 residues), 235.1 bits, see alignment E=7.9e-74

Best Hits

Swiss-Prot: 61% identical to DGOD_RALPJ: D-galactonate dehydratase (dgoD) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K01684, galactonate dehydratase [EC: 4.2.1.6] (inferred from 78% identity to aav:Aave_2244)

MetaCyc: 57% identical to D-galactonate dehydratase (Escherichia coli K-12 substr. MG1655)
Galactonate dehydratase. [EC: 4.2.1.140, 4.2.1.6]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.140 or 4.2.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>ABIE51_RS10935 galactonate dehydratase (Lysobacter sp. OAE881)
MTDRTQRARTPTRMKITAISTFLVPPRWCFVRIDTDAGISGWGEPIVEGRAHTVAAAVDE
LSDYLIGKDPRFIEDHWNVMYRGGFYRGGPILMSALAGIDQALWDIHGKALGVPVHALLG
GQVRDRIRVYSWIGGDRPAETARAAKDAVARGFSAVKMNATEEVQFVDTHEKVSRVLENV
QAVRDAVGREVGLAVDFHGRVHKPMAKVLMRELAPFGLMFIEEPVLSEHLECIPELASLS
PAPIALGERLYSRFDFKRVLQTGGVDIIQPDPSHSGGITETRKIAAMAEAFDVALALHCP
LGPIALAANLQLDAVCYNAFIQEQSLGIHYNANNDLLDYLTDRAPFAYEGGYVAIPQGPG
LGIEINQEYVDERAAEGHRWRNPIWRHADGSVAEW