Protein Info for ABIE51_RS10930 in Lysobacter sp. OAE881

Annotation: 2-dehydro-3-deoxy-6-phosphogalactonate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01081: Aldolase
  • amino acids 6 to 187 (182 residues), 110.1 bits, E=5.1e-36

Best Hits

Swiss-Prot: 48% identical to DGOA_ECOLI: 2-dehydro-3-deoxy-6-phosphogalactonate aldolase (dgoA) from Escherichia coli (strain K12)

KEGG orthology group: K01631, 2-dehydro-3-deoxyphosphogalactonate aldolase [EC: 4.1.2.21] (inferred from 67% identity to avn:Avin_51330)

MetaCyc: 48% identical to 2-dehydro-3-deoxy-6-phosphogalactonate aldolase (Escherichia coli K-12 substr. MG1655)
2-dehydro-3-deoxy-6-phosphogalactonate aldolase. [EC: 4.1.2.21, 4.1.2.55]

Predicted SEED Role

"2-dehydro-3-deoxyphosphogalactonate aldolase (EC 4.1.2.21)" in subsystem D-galactonate catabolism (EC 4.1.2.21)

MetaCyc Pathways

• superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
• Entner-Doudoroff pathway I (8/9 steps found)
• D-galactonate degradation (3/3 steps found)
• Entner-Doudoroff shunt (2/2 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (7/9 steps found)
• 4-deoxy-L-threo-hex-4-enopyranuronate degradation (4/5 steps found)
• D-fructuronate degradation (3/4 steps found)
• superpathway of β-D-glucuronosides degradation (5/7 steps found)
• D-galacturonate degradation I (3/5 steps found)
• 3,6-anhydro-α-L-galactopyranose degradation (4/7 steps found)
• D-glucosaminate degradation (1/3 steps found)
• superpathway of hexuronide and hexuronate degradation (6/10 steps found)
• L-glucose degradation (3/7 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (11/31 steps found)

KEGG Metabolic Maps

• Galactose metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.21

Use Curated BLAST to search for 4.1.2.21 or 4.1.2.55

Protein Sequence (208 amino acids)

>ABIE51_RS10930 2-dehydro-3-deoxy-6-phosphogalactonate aldolase (Lysobacter sp. OAE881)
MSTAWLQPLPLIAILRGLTPQDALPVGAALFDAGFRVIEVPLNSPQPLESIALLAREFGD
RCLVGAGTVLTPGQVAQVKNAGGKLIVMPHGDTTVIRAAKAADLVCTPGVATPTEAFAAL
AAGADALKLFPAEQLPPPVLKAWSSVLPKGTALLPVGGITPDNMGAYRKAGAAGFGIGSA
LYSPGIDATETARRARAFVDGWNSINLT