Protein Info for ABIE51_RS10810 in Lysobacter sp. OAE881

Annotation: quinoprotein dehydrogenase-associated putative ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR03871: quinoprotein dehydrogenase-associated probable ABC transporter substrate-binding protein" amino acids 21 to 258 (238 residues), 281.8 bits, see alignment E=2.2e-88 PF00497: SBP_bac_3" amino acids 22 to 245 (224 residues), 44.3 bits, see alignment E=8.1e-16

Best Hits

KEGG orthology group: None (inferred from 60% identity to mci:Mesci_6201)

Predicted SEED Role

"Bll6196 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>ABIE51_RS10810 quinoprotein dehydrogenase-associated putative ABC transporter substrate-binding protein (Lysobacter sp. OAE881)
MKSHVSMLLLLLACTNAEARELRVCADPNNLPFSNRDGEGFENRIAEIVAKELDAELVYT
WWAQRRGALRNTIRAGKCDVVPGIAAGIEGLSTTRPYYRATYVFVSRRDGRWAGLSSFDD
PRLRDATIGVQLIGDDGANTPPAHALARRGMYANIRGFTVYGDYADAAPQSDIVAAVVDG
RVDVAAVWGPTAGYFARRFPSLQLAPVTPWLDGPQWPMTFEISFAVRREDRELRRELDRA
LERHAAEIARVLEDFGVPVESPNPATASN