Protein Info for ABIE51_RS10220 in Lysobacter sp. OAE881

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 PF00106: adh_short" amino acids 45 to 231 (187 residues), 160.8 bits, see alignment E=4.4e-51 PF08659: KR" amino acids 48 to 197 (150 residues), 46.4 bits, see alignment E=6.6e-16 PF13561: adh_short_C2" amino acids 53 to 285 (233 residues), 195 bits, see alignment E=2.3e-61

Best Hits

Swiss-Prot: 46% identical to YHDF_BACSU: Uncharacterized oxidoreductase YhdF (yhdF) from Bacillus subtilis (strain 168)

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 76% identity to xcc:XCC3695)

MetaCyc: 47% identical to NADP+-dependent aldehyde reductase (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

"Oxidoreductase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>ABIE51_RS10220 SDR family oxidoreductase (Lysobacter sp. OAE881)
MTVPDYPRPPFKPQQQSFPGKTDKMDPRPDHGEDSYVGHGLLAGKKALITGGDSGIGAAV
AIAFAREGADVAIVHLPTEEKDAQRILELVKKAGVDGVALACDISDPELAAKTVESVAER
FGRIDVLVNNAAYQKYYESMEEITLDEWTKHFNTNVHAPFNLVRLALPHMQEGASVINTA
SVQSKKPSPNILPYAATKGAIANMTVGLAGLLAEKKIRVNAVLPGPIWTPFIPAGMAPEE
VETFGEQTPFKRPGQPVELASAYVMLAADTSSYTSGALLTVSGGAATL