Protein Info for ABIE51_RS10110 in Lysobacter sp. OAE881

Annotation: hydrogenase subunit MbhD domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 50 (18 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 90 to 113 (24 residues), see Phobius details amino acids 120 to 143 (24 residues), see Phobius details amino acids 150 to 167 (18 residues), see Phobius details amino acids 187 to 209 (23 residues), see Phobius details amino acids 220 to 237 (18 residues), see Phobius details amino acids 249 to 275 (27 residues), see Phobius details amino acids 283 to 305 (23 residues), see Phobius details PF13244: MbhD" amino acids 11 to 76 (66 residues), 53.2 bits, see alignment E=2.7e-18 PF04039: MnhB" amino acids 187 to 300 (114 residues), 40.4 bits, see alignment E=3.5e-14

Best Hits

KEGG orthology group: None (inferred from 55% identity to msl:Msil_1035)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>ABIE51_RS10110 hydrogenase subunit MbhD domain-containing protein (Lysobacter sp. OAE881)
MNGAPTLALIALILGLALWIVLARETFAAVAGFIAYGLLLTLAWVGLSAVDVAMTEAAIG
AGLTGALLIGAASRLRGGGYAEVRMQRGLAVRVLAIAASVGVTAVLIVCLRLLPEPSPTL
APLVTEHLTATGVGNPITAVLLAFRAMDTLLEAIVLLFALIAVWSLTPDAAWGQPPDVSH
DADPQGVLAYVARVLPPIGIVIAVYILWVGADAPGSKFQGATILASMWLLVMMAGLTRAP
PVSSMALRAWLVAGPLVFVAIGLYGAWMAGAFLAYPDGAAKPLIVVIEIALMPSLAVILA
LLLAGAPRDAGAVP