Protein Info for ABIE51_RS09935 in Lysobacter sp. OAE881

Annotation: PepSY-associated TM helix domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 166 to 188 (23 residues), see Phobius details amino acids 212 to 241 (30 residues), see Phobius details amino acids 372 to 393 (22 residues), see Phobius details amino acids 413 to 433 (21 residues), see Phobius details amino acids 450 to 470 (21 residues), see Phobius details amino acids 482 to 499 (18 residues), see Phobius details amino acids 511 to 532 (22 residues), see Phobius details PF03929: PepSY_TM" amino acids 10 to 395 (386 residues), 214.9 bits, see alignment E=1.1e-67

Best Hits

KEGG orthology group: None (inferred from 79% identity to psu:Psesu_1886)

Predicted SEED Role

"FIG138928: iron-regulated membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (554 amino acids)

>ABIE51_RS09935 PepSY-associated TM helix domain-containing protein (Lysobacter sp. OAE881)
MLNSFRQSMAWLHTWFGLVLGFVLMAAFFFGALSVFDREIDRWSNPATRFEPQPMPSYDK
VLRPAFERMQPTKDAVDAMRPRVNGDMPQRFDTVVSWSAYTTHRDPVLALYAGYEVPNAK
DPEEAIWAYGTIDPRNGRVLSNDQLKIGSEFFYPMHYSLTLDWKNLGFWIVGFSALVMLA
ALVSGVVMHRKIFREFFTFRPDKARLRSVLDLHNLTGVVALPFHFFFAFTGLVIFAGTYY
FPVGHTQLHDLHELHAQIEANETGLPHERAGVAAGLASVDGMVAEAQRRWQAKDKAGDVG
FLVLQHVGDANGYVSVYRAGTDRIALVGDGIHFKASTGELIREDPPASAVGRVSEFLTGL
HLQHFRHWLLRWLYVLGGLAGAVCIATGFVFFVEKRKRQHAQQGSQGARIVDALAVTTVT
GMVLAALGILVANRLLPETLPGRGDFERYAFWGTWALAFVHAGLRSAPVAQGRANPAWRE
QCWAIAMLAVGAVALNWITTGDHLLKTLTAGYWPVAGVDLFLLFGATVAAVTARKLTKNA
AIAQPRIDTEPAHV