Protein Info for ABIE51_RS09385 in Lysobacter sp. OAE881

Annotation: tRNA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 TIGR02222: export-related chaperone protein CsaA" amino acids 7 to 110 (104 residues), 125.1 bits, see alignment E=5.7e-41 PF01588: tRNA_bind" amino acids 18 to 109 (92 residues), 38.1 bits, see alignment E=6.9e-14

Best Hits

Swiss-Prot: 45% identical to CSAA_BACSU: Probable chaperone CsaA (csaA) from Bacillus subtilis (strain 168)

KEGG orthology group: K06878, tRNA-binding protein (inferred from 66% identity to dvu:DVU0028)

Predicted SEED Role

"Protein secretion chaperonin CsaA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (111 amino acids)

>ABIE51_RS09385 tRNA-binding protein (Lysobacter sp. OAE881)
MSETISWADFEKVMLCAGTVQRVEEFPEARKPAWKLWVDFGPHGVRKTSAQVKHLYAAEE
LVGRQIVGVINFPPKQVGPFISEFLLTGFPTEEGVVITTIERPVPNGTRMA