Protein Info for ABIE51_RS07570 in Lysobacter sp. OAE881

Annotation: enoyl-CoA hydratase-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 12 to 259 (248 residues), 230.3 bits, E=2.4e-72
• PF16113: ECH_2
  • amino acids 14 to 197 (184 residues), 138.6 bits, E=3.7e-44

Best Hits

Swiss-Prot: 49% identical to HPCD_METS5: 3-hydroxypropionyl-coenzyme A dehydratase (Msed_2001) from Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)

KEGG orthology group: K01715, 3-hydroxybutyryl-CoA dehydratase [EC: 4.2.1.55] (inferred from 75% identity to sml:Smlt1558)

MetaCyc: 49% identical to 3-hydroxypropionyl-CoA dehydratase (Metallosphaera sedula)
RXN-6383 [EC: 4.2.1.116]

Predicted SEED Role

"Enoyl-CoA hydratase (EC 4.2.1.17)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation (EC 4.2.1.17)

MetaCyc Pathways

• superpathway of glyoxylate cycle and fatty acid degradation (12/14 steps found)
• oleate β-oxidation (27/35 steps found)
• acrylate degradation II (3/3 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• fatty acid salvage (5/6 steps found)
• adipate degradation (4/5 steps found)
• fatty acid β-oxidation II (plant peroxisome) (4/5 steps found)
• L-tryptophan degradation III (eukaryotic) (11/15 steps found)
• (2S)-ethylmalonyl-CoA biosynthesis (3/4 steps found)
• L-isoleucine degradation I (4/6 steps found)
• methyl ketone biosynthesis (engineered) (4/6 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• adipate biosynthesis (3/5 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• acetyl-CoA fermentation to butanoate (4/7 steps found)
• fatty acid β-oxidation I (generic) (4/7 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
• 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (6/10 steps found)
• propanoate fermentation to 2-methylbutanoate (3/6 steps found)
• 3-hydroxypropanoate cycle (8/13 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• valproate β-oxidation (5/9 steps found)
• glycerol degradation to butanol (10/16 steps found)
• fatty acid β-oxidation IV (unsaturated, even number) (2/5 steps found)
• propanoyl-CoA degradation II (2/5 steps found)
• pyruvate fermentation to butanol I (4/8 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
• pyruvate fermentation to butanoate (3/7 steps found)
• 3-phenylpropanoate degradation (5/10 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (5/10 steps found)
• β-alanine biosynthesis II (2/6 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (4/9 steps found)
• acrylate degradation I (1/5 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
• L-valine degradation I (3/8 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (5/11 steps found)
• benzoyl-CoA degradation I (aerobic) (2/7 steps found)
• glyoxylate assimilation (6/13 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (5/13 steps found)
• phenylacetate degradation I (aerobic) (2/9 steps found)
• ethylmalonyl-CoA pathway (3/11 steps found)
• superpathway of the 3-hydroxypropanoate cycle (8/18 steps found)
• L-glutamate degradation VII (to butanoate) (3/12 steps found)
• gallate degradation III (anaerobic) (2/11 steps found)
• superpathway of phenylethylamine degradation (2/11 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (6/17 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (3/13 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (3/14 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (3/16 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (3/17 steps found)
• toluene degradation VI (anaerobic) (3/18 steps found)
• platensimycin biosynthesis (6/26 steps found)
• Spodoptera littoralis pheromone biosynthesis (3/22 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.116 or 4.2.1.17 or 4.2.1.55

Protein Sequence (260 amino acids)

>ABIE51_RS07570 enoyl-CoA hydratase-related protein (Lysobacter sp. OAE881)
MSETPVLTADRGAVRVVTVNRPDKLNALNAATLDALLAAFEAAAADPSVRCVVLTGAGPK
AFVAGADIAEMNGLTAVQGRDFSLRGQKLMRRVEKMPKPVIGMINGFALGGGLELAMGCH
LRIAADTAKVGQPEINLGLIPGFGGTQRLLRLAGRAATLELCLVGAPIDAARARELGIVN
RVVPAAELEAETMKLAEQIANSAPLALRGVLDCVNVGGECGIEEGLEYETAQFGLMFATQ
DMREGTTAFLERRKPNFSGQ