Protein Info for ABIE51_RS06930 in Lysobacter sp. OAE881

Annotation: cation diffusion facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 17 to 36 (20 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 151 to 177 (27 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 15 to 290 (276 residues), 249.7 bits, see alignment E=1.8e-78 PF01545: Cation_efflux" amino acids 21 to 205 (185 residues), 136.1 bits, see alignment E=6.6e-44

Best Hits

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 51% identity to gau:GAU_1960)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>ABIE51_RS06930 cation diffusion facilitator family transporter (Lysobacter sp. OAE881)
MGHGHHHDHTAISSTRAFAAVTLINLAYTALEAGYGFATNSLALLSDALHNFGDVLGLGL
AWGAAALARRAPTDRHTYGWRRATLLSPLANAVLLVGFSGALAWEAMRRFNAPPQIPALP
VMIVAAIGIAVNLGAAWLVREGHEQDLNRRGAFLHLIADAAVSLAAVIAGAGIWWLGWEW
LDPAIALLVSVVVAVGAFGLLRDAFNAAMDAVPPSIRQTEVQDFLASQPGVQAVHHLHIW
SLGAGEIAMTAHLVRPMAGTDLGEHDAFIDRLNRELDQRFGINHPTLQVELGRACEHDRH
DRAPHGAHEHRHPHGHDHAH