Protein Info for ABIE51_RS06600 in Lysobacter sp. OAE881

Annotation: rhomboid family intramembrane serine protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 56 to 80 (25 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details PF08551: DUF1751" amino acids 51 to 136 (86 residues), 35 bits, see alignment E=1.8e-12 PF01694: Rhomboid" amino acids 51 to 202 (152 residues), 117.8 bits, see alignment E=4.5e-38

Best Hits

KEGG orthology group: None (inferred from 69% identity to psu:Psesu_1859)

Predicted SEED Role

"FIG056164: rhomboid family serine protease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (217 amino acids)

>ABIE51_RS06600 rhomboid family intramembrane serine protease (Lysobacter sp. OAE881)
MFSNLPPVTKALLIANGLVFVLQLIIGDVALAQFMLWPPHSDADLYGVGFMPWQVVTYGF
MHGGFAHLLFNMLALAMFGAPLEHVWGDRRYLTYYMVCIVGAALCQLAVGMWTVSQGEPA
YPTVGASGGIFGLLLAYGMLFPNQRVMLLIPPIPMKARTLVIVYGAIELLLGITNTMPGV
AHFAHLGGMLFGWLLIRYWRGQPPFGRKGPPKMRVVR